PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00001965-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 491aa    MW: 56064.7 Da    PI: 6.1455
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00001965-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR159.21.3e-18101190291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y++YAk++GF++rk +++k  +++   ++tfv s+ g++ +++ + +    ++++tr++C+a l+v + + g w+vt++ +eHnHel
  SMil_00001965-RA_Salv 101 LYCAYAKHMGFNLRKGNEEKFVQTKGLRMKTFVYSCRGSTPSSHIDGRLPVYKKQSTRCNCQALLRVARVNGGPWKVTTFTKEHNHEL 188
                            59*******************99999***************99999888999***********************************9 PP

                   FAR1  90 ap 91 
                             p
  SMil_00001965-RA_Salv 189 LP 190
                            75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.6E-15101190IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MVLALNVPTG VDELEYYNNI VNDDAIDWGM NNVRNEDFSA YGFETEEDVN EEEVNVEDVE  60
SEFVHDGADA ANEYVNSTAR ELEDKLAPGC LVDGVDEAFL LYCAYAKHMG FNLRKGNEEK  120
FVQTKGLRMK TFVYSCRGST PSSHIDGRLP VYKKQSTRCN CQALLRVARV NGGPWKVTTF  180
TKEHNHELLP KDQAYLLRSS HHLLHAKKSM LEALKSAGIP ISWACRFMEN ESGGSENAEF  240
IRRDAYHHMD NVRRKSKMAD GDSTALMQLS RDAKTRNRLA VGEGVRGRSH CHISLPNSAM  300
NSHMMCEMYE LLNDDRLDET SRQIIVLKFD ELQKEIHKQL QSVRQGAKPH DDASMQNQTS  360
FMRTPVHDPP IPVKRRFINT RLSRHWERPK KRGRKTGNAL GREANSQATA SSNVPLNGLD  420
TSNEMLLEHF TIWYDDQSNT VYAAEATWDL IRQRYRNLMC YNPEGEKNWA ILKELYDDPE  480
TTTSESSAND E
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G10240.14e-16FAR1-related sequence 11